Espanol English

Bloqueadores de miostatina? q tan efectivos? pienso q mucho!

Suplementos nutricionales para el culturismo, vitaminas y minerales, precursores hormonales, DHEA, Tribulus terrestris, Androstenedione, Chrysin, Lipoic acid, Creatina, Glutamina, Taurina. Estimulantes de la Hormona de crecimiento humana y la testostreona.

Bloqueadores de miostatina? q tan efectivos? pienso q mucho!

Notapor Darth Pincho » Vie Jun 15, 2007 9:26 am

Hola a todos. Hace ya mucho tiempo lei en una musclemag un articulo sobre un suplemento que bloqueaba los receptores o la produccion de una sustancia llamada miostatina. No recuerdo bien.

Pero en palabras simples la miostatina es una sustancia que bloquea el crecimiento msucular excesivo. Estableciendo un limite en nuestros cuerpos y causando resistencia al aumento excesivo de musculo y peso. Este producto reducia la miostatina o se enlazaba en sus receptores de modo que el crecimiento es libre.

Me gustaria que alguien con un pcoo mas de tiempo que yo investigue ese asunto para postearlo aqui. Desde mi punto de vista si funciona esto seria tan importante como el descubrimeinto de la creatina y taurina.
Avatar de Usuario
Darth Pincho
Administrador del sitio
Administrador del sitio
 
Mensajes: 1590
Registrado: Vie Nov 29, 2002 10:04 pm
Ubicación: Caracas - Venezuela





Notapor CaSTe » Vie Jun 15, 2007 11:06 am

Esto es lo que he encontrado mas rápido, es un tema bastante nuevo, y todo esta todavia por estudiar, en ellos estan.
saludos!

Miostatina (formalmente conocida como factor 8 de crecimiento y diferenciación) es un factor de crecimiento que limita el crecimiento del tejido muscular, por ejemplo concentraciones más altas del Miostatina en un individuo causa que menos músculos de lo normal se desarrollen. La proteína Miostatina es producida en células del músculo esquelético, circula en sangre y actúa en tejido muscular, al parecer retrasando el desarrollo de las células madre musculares. El mecanismo exacto sigue siendo desconocido. Miostatina y el gen asociado fueron descubiertos en 1997 por los genetistas McPherron y Se-Jin Lee, que también produjeron una estirpe del mutante en ratones con la carencia del gen y era alrededor de dos veces más fuerte que ratones normales. (En esta imagen se puede ver 3 tipos de ratones: normal, mutante heterocigótico y mutante homocigótico, respectivamente.(fuente: http://www.mesomorphosis.com))


El gen ha sido secuenciado en humanos, ratones, pez cebra y varios otros animales, demostrando pocas diferencias entre especies. Lee encontró en 1997 que el Azul Belga fuerte y una camada de Piedmontese tenían el gen de la Miostatina defectuoso; estas estirpes se han producido a través crianza. (En esta imagen se ve un Azul Belga fuerte por mutación en el gen de la miostatina.(fuente: http//www.pharyngula.org)

En 2001, Lee creo ratones con el gen intacto de la Miostatina y con gran masa muscular insertando mutaciones que aumentaran la producción de sustancias bloqueadoras de la Miostatina. En 2004, un muchacho alemán fue diagnosticado con una mutación en ambas copias del gen que produce la Miostatina, haciéndolo considerablemente más fuerte que sus pares. Su madre, tenía una mutación en una copia del gene.

Investigación adicional en Miostatina y el gene de la Miostatina puede conducir a terapias para la distrofia muscular. La idea es introducir sustancias que bloquean la Miostatina. En 2002, investigadores de la Universidad de Pennsylvania demostraron que con un anticuerpo monoclonal específico para la Miostatina mejora la condición de ratones con distrofia muscular, probablemente mediante el bloqueo de la acciona de la Miostatina.

En 2005, Lee demostró que con un tratamiento de dos semanas a ratones normales con el receptor de la activita tipo 11B soluble, una molécula que se une normalmente a las células y a Miostatina, conduce a un aumento notable en la masa del músculo (hasta el 60%). Se piensa que la unión de la Miostatina al receptor soluble impide que ella se una al receptor de la superficie celular.

Sigue siendo confuso si un tratamiento largo de la distrofia muscular con los inhibidores de la Miostatina es beneficioso: el agotamiento de las células madre musculares podría empeorar la enfermedad más adelante.

Hasta 2005, no hay drogas en el mercado que inhiban la Miostatina para los seres humanos, pero fue desarrollado un anticuerpo genéticamente modificado para reconocer la Miostatina y neutralizarla por la compañía farmacéutica de New-Jersey Wyeth. El inhibidor se llama MYO-029 y está actualmente en fase experimental en humanos. Algunos atletas, impacientes conseguir tales drogas, buscan por Internet, donde se están vendiendo bloqueadores de la Miostatina falsos. La Miostatina es un miembro de la superfamilia de proteínas TGF-beta. La Miostatina humana consiste en dos subunidades idénticas, cada una consiste en 110 residuos de aminoácidos. Su peso molecular total es de 25.0 kDa. Puede ser producido E. coli modificada genéticamente y esta disponible para la venta. La Universidad De Johns Hopkins posee las patentes de la Miostatina.
Avatar de Usuario
CaSTe
Forista Senior
Forista Senior
 
Mensajes: 328
Registrado: Vie Ago 01, 2003 1:56 pm
Ubicación: España (bcn)

Notapor escobars » Vie Jun 15, 2007 11:20 am

MUY BUENA INFORMACION Y KE BUENO KE INVENTEN COSAS ASI... MUCHAS GRACIAS CASTE Y A DARTH
MUCHO SUDOR, JUICIO Y DEDECACION...
Avatar de Usuario
escobars
Forista Senior
Forista Senior
 
Mensajes: 389
Registrado: Vie Nov 03, 2006 10:17 pm
Ubicación: COLOMBIA.

Notapor j.c. » Vie Jun 15, 2007 12:14 pm

En la actualidad (2007), compañias farmaceuticas, estan estudiando el uso del ACE-031, un bloqueador de la Miostatina

Genetic Engineering & Biotechnology News
http://www.genengnews.com/news/bnitem.a ... e=17453743
(alli un link pero en ingles, no hay nada en español de este estudio)
Me apasiona este tema :D
Avatar de Usuario
j.c.
Forista Legendario
Forista Legendario
 
Mensajes: 622
Registrado: Vie Feb 09, 2007 1:54 pm
Ubicación: ARG

HIPERTROFIA MUSCULAR HEREDITARIA

Notapor r130 » Lun Jun 18, 2007 2:32 am

http://www.dcam.upv.es/acteon/docs/barroso.pdf

Pues aun no hay novedades en cuanto a la comercializacion de inhibidores de myostatina farmaceuticos, Las empresas de suplementos aseguran que una alternativa natural es el alga Cystoseira canariensis, que se ofrece en productos como MYO-BLAST de Laboratorios CYTODYNE .

En cuanto a las tecnologias de GMO Organismos Geneticamente Modificados podemos ver resultados mas obvios.

Este es un ensayo titulado"LA HIPERTROFIA MUSCULAR HEREDITARIA: GÉNESIS DE ALELOS
DOMINANTES NEGATIVOS DE LA MIOSTATINA (GDF-8) MURINA"

La Hipertrofia Muscular (HM) Hereditaria es un síndrome descrito en las especies
murina y bovina (donde también es conocido como “doble grupa” o “cularidad”) que
provoca, como característica más sobresaliente, un incremento generalizado de la masa
muscular del animal (figura 1). A nivel macroscópico, se advierte además una reducción
muy marcada del tamaño de los órganos, así como un descenso moderado en el índice de
transformación.


http://www.dcam.upv.es/acteon/docs/barroso.pdf
Avatar de Usuario
r130
Forista Senior
Forista Senior
 
Mensajes: 361
Registrado: Lun Jul 31, 2006 1:38 pm
Ubicación: Lima - Peru

Notapor destruccion » Vie Jul 13, 2007 10:55 am

esa alternativa natural de las algas está demostrado que no sirve para nada. La Biblioteca Pública Nacional de Medicina de los EEUU publican un estudio, donde se demuestra científicamente que los suplementos hechos a base de dicha alga, no sirven para nada, analizando el nivel sérico de la miostatina tanto en pacientes suministrados con el supuesto bloqueador y en pacientes administrados con un placebo.

http://www.ncbi.nlm.nih.gov/entrez/quer ... ids=154671 03&dopt=Abstract

El unico pruducto que parece funcionar bien solo que aun esta en fase de prueba es el que están desarrollando los laboratorios wyeth. No se el tiempo que demoré en salir al mercado, pero tengo las esperanzas que sea pronto. :lol:
Avatar de Usuario
destruccion
Forista Legendario
Forista Legendario
 
Mensajes: 746
Registrado: Mar Oct 31, 2006 3:12 pm
Ubicación: LIMA-PERU

Notapor elpolicia » Vie Jul 13, 2007 11:36 am

NINGUN SUPLEMENTO COMO DICE EL PANA DESTRUCUCION SIRVE Y ESO ESTA YA DEMOSTRADO MAS QUE CLARO Y EN VARIOS PAISES, SE ESTA TRABAJANDO EN ADN RECOMBINANTE PARA SER INYECTADO EN LA MEDULA QUE ES LA VERDADERA FORMA DE ADMINISTRARLO Y QUE TRABAJE DE RESTO TODO ES PURA PAJA Y PERDIDA DE TIEMPO Y DINERO, SERIA BUENO ESPERAR MAS INFO DE ESTE TEMA Y NO CREER EN LO PRIMERO QOUE SALGA AL MERCADO.
elpolicia
Lider de Clan
Lider de Clan
 
Mensajes: 2530
Registrado: Dom Dic 08, 2002 8:51 am
Ubicación: BANEADO

Notapor JSeemann » Vie Jul 13, 2007 11:44 am

De acuerdo con la fuente "Clayton South's Healt Facts, el bloquedor de myostatina está disponible y funciona de la sigiente manera:
La myostatina es la proteína que regula cuanta masa muscular es producida. Si el gene que encripta a la myostatina es ocultado o preferentemente bloqueado, dichos estudios en humanos revelan un mas rápido crecimiento muscular. En ratones ha sido experimentado no solamente bloquerar sino literalmente eliminar el gene y aún sin ejercicio desarrollaron de dos a tres veces que los ratones sin bloqueo. En humanos no es posible realizar el bloqueo completo, sin embargo existen dos productos, de dos laboratorios distintos, que inhiben (no bloquean) a la myostatina e inducen a la hipertrofia, de acuerdo con los resulrtados de los estudios practicados.
La muestra de voluntarios para salir al mercado con los productos varió en función a la resistencia del gene regulador, sin embargo en todos los casos se registraron aumentos de masa.
Tengo el nombre de los productos y los laboratorios, pero quisiera saber de algun moderador si es permitido mencionarlos o si es preferible hacerlo vía PM, no quiero violar las reglas del foro, aún y cuando yo no vendo ni promociono nada, simplemente me llamó la atención la publicidad que le están dando en un reciente viaje que realicé a los Estados Unidos.
Espero que esta información sea de su interés y que complementa la solicitud de Darth.
Gracias
JG
Avatar de Usuario
JSeemann
Lider de Clan
Lider de Clan
 
Mensajes: 2760
Registrado: Lun Abr 02, 2007 12:17 pm

Notapor JSeemann » Vie Jul 13, 2007 11:55 am

Si alguien quisiera ver los resultados en los ratones que menciono en el post pasado, así como un toro bloquedo del gene de la myostatina, les pediría me indiquen la forma de subirlas al post.
Gracias
JG
Avatar de Usuario
JSeemann
Lider de Clan
Lider de Clan
 
Mensajes: 2760
Registrado: Lun Abr 02, 2007 12:17 pm

Notapor MaxAguilar » Vie Jul 13, 2007 12:15 pm

Esos productos a los que te refieres con tanto misterio, deben ser dos de ellos que promocionan en usa, ( usen ese "famoso" buscador de internet, señores, veran) a base del algas, las cuales afirma el estudio postedo mas arriba que dice que no sirven para nada, por otro lado algo que me llama mucho la atencion es que son muy baratos, lo que lo hace mas sospechoso todavia, no creo un invento tan maravilloso y nuevo cueste tan poco asi como $35, si no la hormona de crecimiento seria regalada.

Saludos.
MaxAguilar
Nuevo usuario
Nuevo usuario
 
Mensajes: 7
Registrado: Jue Oct 05, 2006 6:57 am
Ubicación: Puerto Ordaz-Venezuela

Notapor elpolicia » Vie Jul 13, 2007 12:43 pm

LAS FOTOS ESTAN YA AQUI EN ESTE FORO NO HAY PARA EL PUBLICO NINGUN PRODUCTO A LA VENTA QUE PUEDA DAR ESOS RESULTADOS ESO ES TOTALMENTE FALSO.

LOS ESTUDIOS CIENTIFICOS SE HAN HECHO CIERTAMENTE TODO LO DE MAS ES PAJA.

ESOS SUPLEMENTOS MIO ZAP, MIO BLAZE O COMO SE LLAMEN SON UNOS DRENADORES DEL BOLSILLO DEL QUE NO TIENE 70 $ POR 80 CAPSULAS DE UN ALGA QUE NI EXISTE Y NADA HACE ES UN ATRACAO AQUI Y EN CHINA, ASI QUE VIAVAN LA REALIDAD TAL VEZ EN 10-15 AÑOS YA ALLA ESTOS PRODUCTOS PERO EN MI OPINOON HAY QUE SER BIEN IMBECIL PARA JODERSE EL ADN CON UNOS KILOS DE MUSCULO QUE NADA SIRVEN (CLARO ESTA SIEMPRE HAY UN IMBECIL QUE LO HACE). :twisted:
elpolicia
Lider de Clan
Lider de Clan
 
Mensajes: 2530
Registrado: Dom Dic 08, 2002 8:51 am
Ubicación: BANEADO

Notapor JSeemann » Vie Jul 13, 2007 12:52 pm

Estoy de acuerdo contigo Policia, solamente expuse los resultados de estudios. Sin embargo puede haber alguien que ya los haya probado y sería bueno su experiencia para confirmar su falta de efectividad. Yo en lo personal creo que SI hay suplementos y complementos que cimplen su cometido y a largo plazo. Los cambios instantaneos en nuestro deporte no existen.
JG
Avatar de Usuario
JSeemann
Lider de Clan
Lider de Clan
 
Mensajes: 2760
Registrado: Lun Abr 02, 2007 12:17 pm

Notapor r130 » Sab Jul 14, 2007 9:58 am

Supongo que deben tener razon respecto a los bloqueadores a base de algas, no los he probado asi que no puedo estar seguro, sin embargo he tenido la oportunidad de converzar con padres de familia de hijos con hipotonias musculares cronicas y ellos le tienen muchisima fe a los productos tipo Myo Blast, y eso que llegan a mi pais costando mas del doble, hay que tener en cuenta que se trata de gente desesperada que necesita poner su fe en cualquier producto milagroso independientementew de si es efectivo o no, pero ellos aseguran buenos resultados.

tengo que reacalcar que esas mismas algas son utilizadas actualmente en muchos procesos industriales (mineros y petroquimicos) porque pueden absorver diversos tipos de toxinas, supongo que por eso pensaron que podia inhibir esa proteina.

No estoy seguro cual seria la intencion de utilizar tecnologia reconbinante en la medula osea, me gustaria ver esos estudios, cuando se utiliza terapia genica en la medula osea generalmente esta relacionada a la hematopoyesis es decir en la produccionb de celulas sanguineas, como los linfocitos en el caso de las leucemias.

Para mi la estrategia logica para utilizar en individuos adultos (ya sea animales o humanos)seria mediante secuencias antisentido que BLOQUEAN la sintesis de la proteina ya que hibridizan con el RNA mensajero y por lo tanto no se expresa la Proteina.

pongo aqui la secuencia de nucleotidos del gen en humanos (no es el GENOMICO es el del RNA mensajero porsiaca) :

1 aaggaagaaa caagaacaag aaaaaagatt atattgattt taaaatcatg caaaaactgc
61 aactctgtgt ttatatttac ctgtttatgc tgattgttgc tggtccagtg gatctaaatg
121 agaacagtga gcaaaaagaa aatgtggaaa aagaggggct gtgtaatgca tgtacttgga
181 gacaaaacac taaatcttca agaatagaag ccattaagat acaaatcctc agtaaacttc
241 gtctggaaac agctcctaac atcagcaaag atgttataag acaactttta cccaaagctc
301 ctccactccg ggaactgatt gatcagtatg atgtccagag ggatgacagc agcgatggct
361 ctttggaaga tgacgattat cacgctacaa cggaaacaat cattaccatg cctacagagt
421 ctgattttct aatgcaagtg gatggaaaac ccaaatgttg cttctttaaa tttagctcta
481 aaatacaata caataaagta gtaaaggccc aactatggat atatttgaga cccgtcgaga
541 ctcctacaac agtgtttgtg caaatcctga gactcatcaa acctatgaaa gacggtacaa
601 ggtatactgg aatccgatct ctgaaacttg acatgaaccc aggcactggt atttggcaga
661 gcattgatgt gaagacagtg ttgcaaaatt ggctcaaaca acctgaatcc aacttaggca
721 ttgaaataaa agctttagat gagaatggtc atgatcttgc tgtaaccttc ccaggaccag
781 gagaagatgg gctgaatccg tttttagagg tcaaggtaac agacacacca aaaagatcca
841 gaagggattt tggtcttgac tgtgatgagc actcaacaga atcacgatgc tgtcgttacc
901 ctctaactgt ggattttgaa gcttttggat gggattggat tatcgctcct aaaagatata
961 aggccaatta ctgctctgga gagtgtgaat ttgtattttt acaaaaatat cctcatactc
1021 atctggtaca ccaagcaaac cccagaggtt cagcaggccc ttgctgtact cccacaaaga
1081 tgtctccaat taatatgcta tattttaatg gcaaagaaca aataatatat gggaaaattc
1141 cagcgatggt agtagaccgc tgtgggtgct catgagattt atattaagcg ttcataactt
1201 cctaaaacat ggaaggtttt cccct


y por si a alguien le interesa la secuencia de aminoacidos de la proteina:


MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTW
RQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSS
DGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYL
RPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQ
PESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHS
TESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRG
SAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Cuando estaba buscando la secuencia de aminoacidos de la proteina encontre de casualidad las secuencias de las proteinas inhibidoras de miostatina obtenidas por ADN recombinante de las que hablaba el POLICIA, sigo sin saber como se usan ni funcionan pero tratare de investigar al respecto.
Avatar de Usuario
r130
Forista Senior
Forista Senior
 
Mensajes: 361
Registrado: Lun Jul 31, 2006 1:38 pm
Ubicación: Lima - Peru

Notapor davidgr1988 » Lun Jul 16, 2007 7:59 am

Como ya se ha dicho mas arriba, el unico inhibidor eficaz de la miostanina esta en fase experimental y todavia no a la venta, y es un medicamento, no un suplemento, esos suplementos no son mas que placebo que haran que perdais dinero y ganas.
davidgr1988
Novato Raso
Novato Raso
 
Mensajes: 46
Registrado: Lun Jul 09, 2007 1:41 pm
Ubicación: Granada

Notapor r130 » Lun Jul 16, 2007 11:09 am

El unico inhibidor eficaz???

David, arriba se ha explicado de varios inhibidores de myostatina farmaceuticos. los inmunologicos (monoclonales), los fisiologicos, los bloqueadores de la transcripcion, los bloqueadores de la traduccion y los bloqueadores de la expresion genomica, cual es el UNICO del que hablas?????
Avatar de Usuario
r130
Forista Senior
Forista Senior
 
Mensajes: 361
Registrado: Lun Jul 31, 2006 1:38 pm
Ubicación: Lima - Peru

Notapor davidgr1988 » Vie Jul 20, 2007 10:04 am

El que estaba en investigacion era MYO-029. y actuaba eficazmente, pero segun se ve no ha debido ser tan efectivo, porque un compañero ha escrito que se esta investigando el ACE-031, en cualquier caso todavia no existe producto alguno que inhiba la miostatina, ni medicamento ni suplemento, puesto que todos estan en fase experimental( en caso de los medicamentos).
davidgr1988
Novato Raso
Novato Raso
 
Mensajes: 46
Registrado: Lun Jul 09, 2007 1:41 pm
Ubicación: Granada

Siguiente


Volver a Suplementos y Vitaminas, Pro Hormonas, Precursores hormonales en el culturismo


 


  • { RELATED_TOPICS }
    Respuestas
    Vistas
    Último mensaje

¿Quién está conectado?

Usuarios navegando por este Foro: No hay usuarios registrados visitando el Foro y 0 invitados

InicioEsteroides AnablicosEjerciciosArtculosGaleriaForosOtrosDescargas
Todos los derechos reservados, Tupincho.net 2002 - 2011 Website powered by Subdreamer CMS
Designed by indiqo.media